Prediction of toxicity score of fragmented polytope (< 50 residues) of envelope protein using ToxinPred tool (https://webs.iiitd.edu.in/raghava/toxinpred/multi_submitfreq_S.php?ran=91595)

Peptide Peptide Sequence SVM* Score Prediction Hydro-phobicity Hydro-pathicity Hydro-philicity Charge Molecular Weight
1 RVKNLNSSRCSYVYSRVKN-LCSLVKPSFYVYCSSLV –0.79 Non-Toxin –0.18 0.05 –0.27 6.00 4263.55
2 KPSFYVCSYVYSRVKNL –1.01 Non-Toxin –0.14 –0.11 –0.37 3.00 2166.82

Support Vector Machine